Protein or peptide name:	PLS
Chromosome:	4
Protein or peptide start site:	18329192
Protein or peptide end site:	18329299
ncRNA start site:	18329094
ncRNA end site:	18329699
Genome Browser:	NA
Protein or peptide sequence:	MKPRLCFNFRRRSISPCYISISYLLVAKLFKLFKIH
Protein or peptide length:	36aa
ncRNA type:	lncRNA
ncRNA name:	PLS
Entrez ID:	3770598
Experimental species:	Arabidopsis thaliana
Experimental techniques:	Microscopy/PCR/Western blotting
Experimental sample (cell line and/or tissue):	Arabidopsis thaliana
Description:	Rapid amplification of cDNA ends PCR, RNA gel blot analysis, and RNase protection assays showed that the PLS ORF is located within a short ( approximately 500 nucleotides) auxin-inducible transcript and encodes a predicted polypeptide of 36 amino acid residues.
Subcellular location:	NA
Function:	The sPEP is required for correct auxin-cytokinin homeostasis to modulate root growth and leaf vascular patterning.
Title of paper:	The POLARIS gene of Arabidopsis encodes a predicted peptide required for correct root growth and leaf vascular patterning
PMID:	12172017
Year of publication:	2002